GRAS comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-04-25. Where a claim depends on a specific study, the study is described rather than over-claimed.
Collagen peptides are short chains of amino acids derived from collagen, a structural protein found in connective tissues such as skin, bone, and cartilage. The production process involves breaking native collagen into smaller fragments through hydrolysis, which cleaves peptide bonds. Unlike intact collagen, these peptides dissolve in water and do not form a triple helix. Commercial preparations typically contain peptides with molecular weights ranging from about 2,000 to 20,000 daltons. The term collagen peptide is often used interchangeably with hydrolyzed collagen or collagen hydrolysate.
Common sources for collagen peptide production include bovine hide, porcine skin, fish skin, and poultry cartilage. The raw material is first cleaned and then treated with enzymes such as pepsin or microbial proteases under controlled conditions. Hydrolysis time, temperature, and enzyme concentration influence the final peptide size distribution. After hydrolysis, the mixture undergoes filtration, purification, and drying to yield a powder. The amino acid composition is notable for high levels of glycine, proline, and hydroxyproline, which are characteristic of collagen.
The functional properties of collagen peptides depend on their molecular weight profile and amino acid sequence. They are highly soluble in water and produce low-viscosity solutions even at relatively high concentrations. Some peptides exhibit surface activity, which allows them to act as emulsifiers or foaming agents in food systems. The absence of a rigid triple-helical structure distinguishes them from gelatin, which can form gels upon cooling. Chromatographic separation and mass analysis are used to characterize the peptide mixture.
Manufacturing collagen peptides begins with collagen-rich raw materials such as bovine hide, porcine skin, fish scales, or poultry cartilage, which undergo washing, size reduction, and pretreatment to remove non-collagen proteins and fats. Extraction may use acid, alkali, or heat. Hydrolysis then breaks the collagen into smaller peptides, often with enzymes such as pepsin, papain, or alcalase. Process conditions of time, temperature, pH, and enzyme dose determine the final molecular weight distribution. After hydrolysis, the solution is filtered, concentrated, and dried into powder.
Quality testing of collagen peptides relies on several analytical methods. Molecular weight distribution is commonly measured by size-exclusion chromatography, sometimes paired with multi-angle light scattering. Amino acid composition is determined by ion-exchange chromatography or reversed-phase high-performance liquid chromatography after acid hydrolysis, while protein content is estimated by Kjeldahl or Dumas nitrogen analysis. Moisture, ash, and heavy metals are checked against specification limits. These tests help ensure consistency and detect adulteration with other proteins.
Regulatory treatment of collagen peptides varies by country and intended use. In the United States, they are typically marketed as dietary supplements or food ingredients, and certain uses may be generally recognized as safe (GRAS) through self-affirmation or notification. In the European Union, collagen peptides from approved animal sources are considered food, not novel foods, if they have a history of consumption. Health claims linking collagen peptides to joint or skin benefits are not approved in the US or EU. Labeling must list the animal source and may state the protein content.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical for spray-dried commercial preparations |
| Solubility | Water-soluble | Dissolves in cold water; no gel formation |
| Average molecular weight | 2,000–20,000 Da | Varies by hydrolysis time and enzyme |
| Typical storage | Cool, dry, sealed container | Protect from moisture and heat |
| Common synonyms | Hydrolyzed collagen, collagen hydrolysate | Used interchangeably in literature |
Collagen peptides are short chains of amino acids produced by hydrolyzing collagen from animal connective tissues. The parent protein occurs in skin, bone, tendons, and cartilage, where it provides tensile strength. Hydrolysis breaks native triple-helical structures into smaller fragments, improving solubility in water. The resulting mixture consists mainly of glycine, proline, hydroxyproline, and other residues. Commercial ingredients are often described by average molecular weight rather than a single defined molecule.
Industrial production typically begins with raw materials such as bovine hide, porcine skin, fish skin, or eggshell membrane. A pretreatment step removes fat and non-collagenous proteins, after which enzymes or acid/alkali conditions cleave peptide bonds. Manufacturers then purify, concentrate, and dry the hydrolysate into a powder. The degree of hydrolysis influences peptide length, solubility, and taste. Because source and process vary, two collagen peptide powders can differ in amino acid profile and molecular weight distribution.
Collagen is a structural protein found in skin, bone, tendon, and cartilage, where it forms triple-helical fibrils. Its amino acid sequence is dominated by repeating glycine-proline-hydroxyproline motifs. Collagen peptides are produced by hydrolyzing native collagen, which breaks the triple helix into shorter chains. The resulting material is water-soluble and has a lower molecular weight than intact collagen. The term covers a family of hydrolysates rather than a single defined compound.
Commercial collagen peptides come from bovine hide and bone, porcine skin, fish skin and scales, and sometimes eggshell membrane. The raw material is cleaned, treated to remove non-collagen proteins and minerals, and then hydrolyzed using enzymes, acid, or alkali. Hydrolysis conditions influence peptide length, amino acid composition, and solubility. The dried product is typically a white to off-white powder with a mild odor. Collagen lacks tryptophan and is rich in glycine, proline, and hydroxyproline, though exact ratios depend on source and process.
== Further reading == Gollner, Adam J. (2010). The Fruit Hunters: A Story of Nature, Adventure, Commerce, and Obsession. Scribner. ISBN 978-0-7432-9695-3. Watson, R. R., and Preedy, V.R. (2010, eds.). Bioactive Foods in Promoting Health: Fruits and Vegetables. Academic Press. ISBN 978-0-12-374628-3.
According to the Australian Forest and Wood Products Research and Development Corporation (FWPRDC), green sawn hardwood, which is sold at about $350 per cubic metre or less, increases in value to $2,000 per cubic metre or more with drying and processing. However, currently used conventional drying processes often result in significant quality problems from cracks, both externally and internally, reducing the value of the product. For example, in Queensland (Anon, 1997), on the assumption that 10% of the dried softwood is devalued by $200 per cubic metre because of drying defects, saw millers are losing about $5 million a year. In Australia, the loss could be $40 million a year for softwood and an equal or higher amount for hardwood. Thus, proper drying under controlled conditions prior to use is of great importance in timber use, in countries where climatic conditions vary considerably at different times of the year. Drying, if carried out promptly after felling of trees, also protects timber against primary decay, fungal stain and attack by certain kinds of insects. Organisms, which cause decay and stain, generally cannot thrive in timber with a moisture content below 20%. Several, though not all, insect pests can live only in green timber. In addition to the above advantages of drying timber, the following points are also significant:
Defence chiefs such as General Magnus Malan welcomed Botha's ascension, blaming previous battlefield reversals—namely, Operation Savannah—on Vorster's indecisive and "lackluster" leadership. Botha had generated a reputation for being a tenacious, uncompromising leader who would use South Africa's position of military strength to strike hard at its foreign enemies, particularly to retaliate against any form of armed provocation. He criticised the West and the US in particular as being unwilling to stand up to Soviet expansionism, and declared that if South Africa could no longer look to the "free world" for support, then it would prevent further communist inroads into the region itself. Within the first three months of his premiership, the length of military service for white conscripts was doubled, and construction began on several new SADF bases near the border. Although little in the tactical situation had changed when Botha assumed office, patrols now crossed into Angola much more frequently to intercept and destroy PLAN cadres along their known infiltration routes. PLAN was attempting to rebuild its forward operating bases after the loss of Chetequera. The insurgents had also been incensed by the Cassinga raid and publicly threatened retribution. "Strike a hard blow which Pretoria will not forget in a long time," deputy PLAN commander Solomon Huwala stated in a written directive to his staff. "We have been concentrating on attacking military targets and their forces, but they have decided to kill women and children.
Sources: en.wikipedia.org
== Discovery == Prohibitins are evolutionarily conserved genes that are ubiquitously expressed. The human prohibitin gene, located on the BRCA1 chromosome region 17q21, was originally thought to be a negative regulator of cell proliferation and a tumor suppressor. This anti-proliferative activity was later attributed to the 3' untranslated region of the PHB gene, and not to the actual protein. Mutations in human PHB have been linked to sporadic breast cancer. However, over-expression of PHB has been associated with a reduction in androgen receptor activity and a reduction in PSA gene expression resulting in a decrease of androgen-dependent growth of prostate cancer cells. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA.
Tylosin is a macrolide antibiotic and bacteriostatic feed additive used in veterinary medicine. It has a broad spectrum of activity against Gram-positive organisms and a limited range of Gram-negative organisms. It is found naturally as a fermentation product of Streptomyces fradiae. Tylosin is used in veterinary medicine to treat bacterial infections in a wide range of species and has a high margin of safety. It has also been used as a growth promotant in some species, and as a treatment for colitis in companion animals.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
== Definition == Vitamin K refers to several structurally similar, fat-soluble vitamers found in foods and marketed as dietary supplements. These are similar in structure in that they share a quinone ring, but differ in the length and degree of saturation of the carbon tail and the number of repeating isoprene units in the side chain (see figures in § Chemistry). Plant-sourced forms are primarily vitamin K1. Animal-sourced foods are primarily vitamin K2. Vitamin K has several roles: an essential nutrient absorbed from food, a product synthesized and marketed as part of a multi-vitamin or as a single-vitamin dietary supplement, and a prescription medication for specific purposes.
North Raleigh is an expansive, diverse, and fast-growing suburban area of the city that is home to established neighborhoods to the south along with many newly built subdivisions and along its northern fringes. The area generally falls North of Millbrook Road. It is primarily suburban with large shopping areas. Primary neighborhoods and subdivisions in North Raleigh include Bartons Creek Bluffs, Bedford, Bent Tree, Black Horse Run, Brier Creek, Brookhaven, Coachman's Trail, Crossgate, Crosswinds, Dominion Park, Durant Trails, Ethan's Glenn, Falls River, Greystone Village, Harrington Grove, Hidden Valley, Lake Park, Long Lake, North Haven, North Ridge, Oakcroft, Shannon Woods, Six Forks Station, Springdale Estates, Stonebridge, Stone Creek, Stonehenge, Summerfield, The Sanctuary, Valley Estates, Wakefield, Weathersfield, Windsor Forest, and Wood Valley. The area is served by a number of primary transportation corridors including Glenwood Avenue US 70, I-540, Wake Forest Road, Millbrook Road, Lynn Road, Six Forks Road, Spring Forest Road, Creedmoor Road, Leesville Road, Norwood Road, Strickland Road, and North Hills Drive.
=== Early stage === In people with early stage Alzheimer's disease, there is increasing impairment of learning and memory. In a small percentage, difficulties with language, executive functions, perception (agnosia), or execution of movements (apraxia) are more prominent than memory problems. Alzheimer's disease does not affect all memory capacities equally. Older memories of the person's life (episodic memory), facts learned (semantic memory), and implicit memory (the memory of the body on how to do things, such as using a fork to eat or how to drink from a glass) are affected to a lesser degree than new facts or memories. Language problems are mainly characterised by a shrinking vocabulary and decreased word fluency, leading to a general impoverishment of oral and written language. In this stage, the person with Alzheimer's is usually capable of communicating basic ideas adequately. While performing fine motor tasks such as writing, drawing, or dressing, certain movement coordination and planning difficulties (apraxia) may be present; however, they are commonly unnoticed. As the disease progresses, people with Alzheimer's disease can often continue to perform many tasks independently; however, they may need assistance or supervision with the most cognitively demanding activities.
Sources: en.wikipedia.org
Gelatin is a partially hydrolyzed form of collagen that retains the ability to form gels in water. Collagen peptides undergo more extensive hydrolysis, resulting in shorter chains that dissolve in cold water without gelling. The two products differ in molecular weight distribution and functional behavior.
Bovine hide, porcine skin, fish skin, and poultry cartilage are common sources. The choice of raw material affects the amino acid profile and the resulting peptide sizes. Fish-derived collagen, for example, typically has a lower melting temperature than mammalian collagen.
No. Native collagen is an insoluble structural protein with a triple-helical conformation. Hydrolysis disrupts this structure, producing water-soluble peptides. The biological and functional properties of the peptides differ from those of the intact protein.
Size-exclusion chromatography is the standard method, often with refractive index or ultraviolet detection. Calibration uses known protein standards. SDS-PAGE can provide a rough range but is less precise.